PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_07028
Common NameKK1_007228
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 224aa    MW: 25118.7 Da    PI: 9.707
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_07028genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  ++q+G g+W++ ++  g+ R++k+c++rw +yl
    C.cajan_07028 14 KGPWTPEEDQILISHIQQYGHGNWRALPKQAGLSRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding57.43.4e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr+++eE+e++++++  lG++ W+tIa +++ gRt++++k++w+++l
    C.cajan_07028  67 RGRFSKEEEEIIIKLHGILGNR-WATIATRLP-GRTDNEIKNFWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.629961IPR017930Myb domain
SuperFamilySSF466891.26E-3110108IPR009057Homeodomain-like
SMARTSM007171.6E-151363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001672.06E-121661No hitNo description
PROSITE profilePS5129427.47462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2665116IPR009057Homeodomain-like
SMARTSM007174.7E-1766114IPR001005SANT/Myb domain
PfamPF002491.3E-1567112IPR001005SANT/Myb domain
CDDcd001671.98E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MVKTPCCEKM GLKKGPWTPE EDQILISHIQ QYGHGNWRAL PKQAGLSRCG KSCRLRWINY  60
LRPDIKRGRF SKEEEEIIIK LHGILGNRWA TIATRLPGRT DNEIKNFWHT HLKKRLERSE  120
LQGSSNSLQE AQAVCSAGSS INMAQGVVDA SDATSSSVDG KLLIANDSLL SRKNPPIVGL  180
GFYGAVSSDI SGQIIRNNSH SVIGEEMEFW YNMFMNSHHK GIKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535378.11e-111PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH42e-72MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A151U5G61e-168A0A151U5G6_CAJCA; Myb-related protein Myb4
STRINGGLYMA19G43740.11e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-70myb domain protein 15